"IL36A" Related Products

Recombinant Human IL36A protein

Cat.No. : IL36A-507H
Product Overview : Recombinant Human IL36A protein (Interleukin-36 alpha, 153a.a.) was expressed in Escherichia coli.
Description : Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. Studies showed IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant human interleukin-36 alpha (153 a.a.) contains 153 amino acids residues which is a single non-glycosylated polypeptide and it shares 57 – 68 % a.a. sequence identity with mouse, rabbit, equine and bovine IL-36α and 27 – 57 % a.a. sequence identity with other novel IL-1 family members.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 300 mM NaCl, pH 8.0, 0.1 % Tween 80.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion in human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg.
Molecular Mass : Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Protein length : 153
AA Sequence : KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Endotoxin : Less than 1 EU/μg of rHuIL-36α, 153a.a. as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of IL36A-507H :

Gene Name : IL36A
Official Symbol : IL36A
Synonyms : IL36A; interleukin 36, alpha; IL1F6, interleukin 1 family, member 6 (epsilon); interleukin-36 alpha; FIL1; FIL1E; IL 1F6; IL1(EPSILON); MGC129552; MGC129553; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; IL-1F6 (FIL-1-epsilon); interleukin 1, epsilon; interleukin-1 family member 6; interleukin 1 family, member 6 (epsilon); IL1F6; IL-1F6; FIL1(EPSILON);
Gene ID : 27179
mRNA Refseq : NM_014440
Protein Refseq : NP_055255
MIM : 605509
UniProt ID : Q9UHA7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.