"Csf1" Related Products

Expand
Expand

Recombinant Rat Csf1

Cat.No.: Csf1-12R
Product Overview: Recombinant Rat Csf1 was expressed in E. coli.
Description: The colony stimulating factor 1 (CSF1), also known as macrophage colony-stimulating factor (M-CSF), is a secreted cytokine which influences hematopoietic stem cells to differentiate into macrophages or other related cell types. Eukaryotic cells also produce M-CSF in order to combat intercellular viral infection. (See colony-stimulating factor.) M-CSF binds to the Colony stimulating factor 1 receptor. It may also be involved in development of the placenta.
Source: E. coli
Species: Rat
Bio-activity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
Molecular Mass: 18.1 kDa
AA Sequence: MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNAN ATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRD VVTKP
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution: Resuspend the protein in the desired concentration in proper buffer
Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ]
Official Symbol: Csf1
Synonyms: Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1
Gene ID: 78965
mRNA Refseq: NM_023981
Protein Refseq: NP_076471
UniProt ID: Q8JZQ0
Chromosome Location: 2q34
Pathway: Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage
Function: cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.