"Csf1" Related Products

Expand
Expand

Recombinant Rat Csf1

Cat.No.: Csf1-15R
Product Overview: Recombinant Rat Macrophage colony-stimulating factor 1/MCSF/Csf1 produced by transfected human cells is a secreted protein with sequence (Gln33-Arg254) of Rat MCSF.
Description: Rat Macrophage colony-stimulating factor 1(MCSF,CSF1) is a single-pass type I membrane cytokine. It is a hematopoietic growth factor that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. MCSF promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It is involved in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development which for normal male and female fertility. It promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. MCSF also plays a role in lipoprotein clearance.
Source: Human Cells
Species: Rat
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4
AA Sequence: EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMR FKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKD WNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQR TEGSSLLPSDLPLRIEDPGSAKQRPPR
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20ºC, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7ºC for 2-7 days. Aliquots of reconstituted samples are stable at < -20ºC for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ]
Official Symbol: Csf1
Synonyms: Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1
Gene ID: 78965
mRNA Refseq: NM_023981
Protein Refseq: NP_076471
UniProt ID: Q8JZQ0
Chromosome Location: 2q34
Pathway: Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage
Function: cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.