Recombinant Human TGFBR3, His-tagged, Biotinylated TGFBR3-698H

Recombinant Human TGFBR3, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TGFBR3, His-tagged, Biotinylated

Recombinant Human TGFBR3, His-tagged, Biotinylated

TGFBR3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TGFBR3-698H
Product Overview : The recombinant human TGFBR3/BGCAN ECD protein is expressed as a 772 amino acid protein consisting of Gly21 - Gly781 region of TGFBR3 (UniProt accession #Q03167) and a C-terminal His tag.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized TGFBR3 protein binds human TGFβ2 in a functional ELISA. Blocks TGFβ2-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 85.7; Estimated by SDS-PAGE under reducing condition (kDa): 95-100
AA Sequence : GPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVH IHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEY GAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNS NPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSI RDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNP PIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIV AVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWP DGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVF SVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMD KKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHE AESKEKGPSMKEPNPISPPIFHGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >75% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : TGFBR3 transforming growth factor, beta receptor III [ Homo sapiens ]
Official Symbol : TGFBR3
Synonyms : TGFBR3; transforming growth factor, beta receptor III; transforming growth factor, beta receptor III (betaglycan, 300kDa); transforming growth factor beta receptor type 3; betaglycan; betaglycan proteoglycan; BGCAN; TGFR-3; TGF-beta receptor type 3; TGF-beta receptor type III;
Gene ID : 7049
mRNA Refseq : NM_001195683
Protein Refseq : NP_001182612
MIM : 600742
UniProt ID : Q03167
Chromosome Location : 1p33-p32
Pathway : TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem;
Function : PDZ domain binding; SMAD binding; coreceptor activity; glycosaminoglycan binding; glycosaminoglycan binding; heparin binding; protein binding; contributes_to protein binding; receptor activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type III; transforming growth factor beta receptor binding; transforming growth factor beta-activated receptor activity; type II transforming growth factor beta receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy