Expand
| Cat.No.: | TGFBR3-698H |
| Product Overview: | The recombinant human TGFBR3/BGCAN ECD protein is expressed as a 772 amino acid protein consisting of Gly21 - Gly781 region of TGFBR3 (UniProt accession #Q03167) and a C-terminal His tag. |
| Source: | Human cells |
| Species: | Human |
| Tag: | His |
| Form: | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity: | Immobilized TGFBR3 protein binds human TGFβ2 in a functional ELISA. Blocks TGFβ2-mediated signaling activity. |
| Molecular Mass: | Calculated molecular mass (kDa): 85.7; Estimated by SDS-PAGE under reducing condition (kDa): 95-100 |
| AA Sequence: | GPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVH IHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEY GAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNS NPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSI RDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNP PIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIV AVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWP DGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVF SVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMD KKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHE AESKEKGPSMKEPNPISPPIFHGSTGHHHHHHHH |
| Endotoxin: | <0.1 eu per 1 μg of purified recombinant protein determined by the lal> |
| Purity: | >75% judged by SDS-PAGE under reducing condition |
| Storage: | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Gene Name: | TGFBR3 transforming growth factor, beta receptor III [ Homo sapiens ] |
| Official Symbol: | TGFBR3 |
| Synonyms: | TGFBR3; transforming growth factor, beta receptor III; transforming growth factor, beta receptor III (betaglycan, 300kDa); transforming growth factor beta receptor type 3; betaglycan; betaglycan proteoglycan; BGCAN; TGFR-3; TGF-beta receptor type 3; TGF-beta receptor type III; |
| Gene ID: | 7049 |
| mRNA Refseq: | NM_001195683 |
| Protein Refseq: | NP_001182612 |
| MIM: | 600742 |
| UniProt ID: | Q03167 |
| Chromosome Location: | 1p33-p32 |
| Pathway: | TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem; |
| Function: | PDZ domain binding; SMAD binding; coreceptor activity; glycosaminoglycan binding; glycosaminoglycan binding; heparin binding; protein binding; contributes_to protein binding; receptor activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type III; transforming growth factor beta receptor binding; transforming growth factor beta-activated receptor activity; type II transforming growth factor beta receptor binding; |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All TGFBR3 Products
Download Datasheet