Recombinant Human ADAM2

PRODUCTS

Home / Products / Antibody / Recombinant Human ADAM2

Recombinant Human ADAM2

ADAM2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADAM2-26413TH
Product Overview : Recombinant full length Human ADAM2, isoform 2 with N terminal proprietary tag. Predicted MW 104.76 kDa.
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
Protein length : 716 amino acids
Molecular Weight : 104.760kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEG IESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGI MKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQF ENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIES RDLSFKLQSVEYNHMGSDTTVVAQKVFQLIGLTNAIFVSF NITIILSSLELWIDENKIATTGEANELLHTFLRWKTSYLV LRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHP RTISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMN PEAIHFSGVKIFSNCSFEDFAHFISKQKSQCLHNQPRLDP FFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATC RFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCN GSSASCPENHYVQTGHPCGLNQWICIDGVCMSGDKQCTDT FGKEVEFGPSECYSHLNSKTDVSGNCGISDSGYTQCEADN LQCGKLICKYVGKFLLQIPRATIIYANISGHLCIAVEFAS DHADSQKMWIKDGTSCGSNKVCRNQRCVSSSYLGYDCTTD KCNDRGVCNNKKHCHCSASYLPPDCSVQSDLWPGGSIDSG NFPPVAIPARLPERRYIENIYHSKPMRWPFFLFIPFFIIF CVLIAIMVKVNFQRKKWRTEDYSSDEQPESESEPKG
Sequence Similarities : Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain.
Gene Name : ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
Official Symbol : ADAM2
Synonyms : ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30;
Gene ID : 2515
mRNA Refseq : NM_001464
Protein Refseq : NP_001455
MIM : 601533
Uniprot ID : Q99965
Chromosome Location : 8p11.2
Function : integrin binding; metalloendopeptidase activity; metallopeptidase activity; zinc ion binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.