"CFH" Related Products

Expand
Expand

Recombinant Human CFH, His-tagged

Cat.No.: CFH-26763TH
Product Overview: Recombinant fragment, corresponding to amino acids 160-463 of Human Factor H with N terminal His tag; 304 amino acids, 35kDa.
Description: This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed by the liver and secreted in plasma.
Form: Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWS KEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKC NMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDY SPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWI PAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYY SYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPY LENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTC MENGWSPTPRCIRVKTCSKSSIDIENGFISES
Sequence Similarities: Contains 20 Sushi (CCP/SCR) domains.
Gene Name: CFH complement factor H [ Homo sapiens ]
Official Symbol: CFH
Synonyms: CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS;
Gene ID: 3075
mRNA Refseq: NM_000186
Protein Refseq: NP_000177
MIM: 134370
Uniprot ID: P08603
Chromosome Location: 1q32
Pathway: Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Staphylococcus aureus infection, organism-specific biosystem; Staphylococcus aureus infection, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.