Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human CFH, His-tagged

Cat.No. : CFH-26763TH
Product Overview : Recombinant fragment, corresponding to amino acids 160-463 of Human Factor H with N terminal His tag; 304 amino acids, 35kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed by the liver and secreted in plasma.
Form : Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWS KEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKC NMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDY SPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWI PAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYY SYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPY LENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTC MENGWSPTPRCIRVKTCSKSSIDIENGFISES
Sequence Similarities : Contains 20 Sushi (CCP/SCR) domains.
Gene Name : CFH complement factor H [ Homo sapiens ]
Official Symbol : CFH
Synonyms : CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS;
Gene ID : 3075
mRNA Refseq : NM_000186
Protein Refseq : NP_000177
MIM : 134370
Uniprot ID : P08603
Chromosome Location : 1q32
Pathway : Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Staphylococcus aureus infection, organism-specific biosystem; Staphylococcus aureus infection, conserved biosystem;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the impact of CFH mutations on the risk of developing atypical hemolytic uremic syndrome (aHUS)? 02/13/2022

Mutations in CFH increase the risk of aHUS, affecting complement regulation and leading to kidney damage.

How does CFH (Complement Factor H) regulate the complement system and prevent overactivation? 06/07/2021

CFH controls the complement system, preventing its overactivation and protecting against immune damage.

How does CFH influence the immune response to bacterial infections? 01/07/2020

CFH modulates the immune response to bacterial infections, balancing defense mechanisms.

How does CFH deficiency contribute to the development of age-related macular degeneration (AMD)? 09/09/2019

CFH deficiency is linked to AMD, due to impaired regulation of the complement pathway in the retina.

What role does CFH play in protecting host cells from complement-mediated damage? 04/03/2019

CFH shields host cells from complement-mediated injury, maintaining tissue integrity.

What are the mechanisms by which CFH modulates inflammation and immune homeostasis? 01/23/2019

CFH regulates inflammation and maintains immune balance, crucial for preventing excessive immune responses.

How do alterations in CFH expression or function affect renal function and the development of kidney diseases? 01/18/2018

Changes in CFH function can impact kidney health, potentially leading to renal diseases due to altered complement activity.

Customer Reviews (3)

Write a review
Reviews
11/16/2020

    Exceptional protein expression optimization support, highly appreciated assistance.

    07/31/2020

      Precise protein quantification, ensures data accuracy in our research.

      03/10/2018

        Timely antibody validation, an invaluable asset for our laboratory.

        Ask a Question for All CFH Products

        Required fields are marked with *

        My Review for All CFH Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends