Recombinant Human CFH protein, His-tagged

Cat.No. : CFH-574H
Product Overview : Recombinant Human CFH protein(P08603)(19-449aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 19-449a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS
Gene Name CFH complement factor H [ Homo sapiens ]
Official Symbol CFH
Synonyms CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; beta-1H; factor H; factor H-like 1; beta-1-H-globulin; H factor 1 (complement); adrenomedullin binding protein; complement factor H, isoform b; age-related maculopathy susceptibility 1; FH; HF; HF1; HF2; AHUS1; AMBP1; ARMD4; CFHL3; MGC88246;
Gene ID 3075
mRNA Refseq NM_000186
Protein Refseq NP_000177
MIM 134370
UniProt ID P08603

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFH Products

Required fields are marked with *

My Review for All CFH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon