Recombinant Human FCER1A, GST-tagged

• Cat.No.: FCER1A-28166TH
• Product Overview: Recombinant Human FCER1A (1 a.a. - 257 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
• Molecular Mass: 54.01 kDa
• AA Sequence: MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ]
• Official Symbol: FCER1A
• Synonyms: FCER1A; FCE1A; FcERI; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
• Gene ID: 2205
• mRNA Refseq: NM_002001
• Protein Refseq: NP_001992
• MIM: 147140
• UniProt ID: P12319
• Chromosome Location: 1q23
• Pathway: Asthma; Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling
• Function: IgE binding; IgE receptor activity