"FCER1A" Related Products

Expand
Expand

Recombinant Human FCER1A, GST-tagged

Cat.No.: FCER1A-28166TH
Product Overview: Recombinant Human FCER1A (1 a.a. - 257 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 54.01 kDa
AA Sequence: MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ]
Official Symbol: FCER1A
Synonyms: FCER1A; FCE1A; FcERI; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
Gene ID: 2205
mRNA Refseq: NM_002001
Protein Refseq: NP_001992
MIM: 147140
UniProt ID: P12319
Chromosome Location: 1q23
Pathway: Asthma; Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling
Function: IgE binding; IgE receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.