Recombinant Human FCER1A, GST-tagged
| Cat.No. : | FCER1A-28166TH |
| Product Overview : | Recombinant Human FCER1A (1 a.a. - 257 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. |
| Molecular Mass : | 54.01 kDa |
| AA Sequence : | MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ] |
| Official Symbol | FCER1A |
| Synonyms | FCER1A; FCE1A; FcERI; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide |
| Gene ID | 2205 |
| mRNA Refseq | NM_002001 |
| Protein Refseq | NP_001992 |
| MIM | 147140 |
| UniProt ID | P12319 |
| Chromosome Location | 1q23 |
| Pathway | Asthma; Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling |
| Function | IgE binding; IgE receptor activity |
| ◆ Recombinant Proteins | ||
| Fcer1a-2376M | Recombinant Mouse Fcer1a protein, His-SUMO-tagged | +Inquiry |
| FCER1A-245H | Recombinant Human FCER1A Protein, His-tagged | +Inquiry |
| FCER1A-2304R | Recombinant Rat Fc epsilon receptor Ia Protein, His tagged | +Inquiry |
| FCER1A-725H | Active Recombinant Human FCER1A, His-tagged | +Inquiry |
| FCER1A-28166TH | Recombinant Human FCER1A, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
| FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *



