"IL4R" Related Products

Expand
Expand
Expand

Recombinant Human IL4R, Fc-tagged

Cat.No.: IL4R-28641TH
Product Overview: Recombinant fragment, corresponding to the signal peptide and extracellular amino acids 1-232 of Human IL4R fused to the Fc region of human IgG1. The chimeric protein was expressed in modified human 293 cells.
Description: This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene.
Conjugation: Fc
Biological activity: The ED50 of IL4R - Fc Chimera is typically 45-60 ng/ml as measured by its ability to neutralize IL-4 mediated proliferation of the human growth factor dependent TF-1 cell line.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Theoretical Sequence:MKVLQEPTCVSDYMSISTCEWKMNGPTNC STELRLLYQLVFLLSEAHTCIPEN NGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPS EHVKPRAPGNL TVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDP ADFRIYNVTYLEP SLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWH NSYREPFEQHG SSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene Name: IL4R interleukin 4 receptor [ Homo sapiens ]
Official Symbol: IL4R
Synonyms: IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124;
Gene ID: 3566
mRNA Refseq: NM_000418
Protein Refseq: NP_000409
MIM: 147781
Uniprot ID: P24394
Chromosome Location: 16p12.1-p11.2
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-4 signaling Pathway, organism-specific biosystem;
Function: insulin receptor substrate binding; interleukin-4 receptor activity; protein binding; receptor activity; receptor signaling protein activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.