| Species : |
Human |
| Source : |
CHO |
| Description : |
This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants. |
| Bio-activity : |
The ED50 was determined by its ability to inhibit the IL-4 dependent proliferation of human TF-1 cells is ≤ 5.0 ng/mL (in the presence of 0.5 ng/mL of IL-4), corresponding to a specific activity of ≥ 2 × 10^5 units/mg. |
| Molecular Mass : |
23.9 kDa |
| AA Sequence : |
GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Purity : |
≥ 95% by SDS-PAGE gel and HPLC analyses. |