Active Recombinant Human IL4R Protein
Cat.No. : | IL4R-01H |
Product Overview : | CHO cell-derived Recombinant Human sIL-4 Receptor α corresponding to 209 amino acid residues of the extracellular domain of IL-4Rα without tag was expressed inn CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants. |
Bio-activity : | The ED50 was determined by its ability to inhibit the IL-4 dependent proliferation of human TF-1 cells is ≤ 5.0 ng/mL (in the presence of 0.5 ng/mL of IL-4), corresponding to a specific activity of ≥ 2 × 10^5 units/mg. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Purity : | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
Gene Name | IL4R interleukin 4 receptor [ Homo sapiens (human) ] |
Official Symbol | IL4R |
Synonyms | IL4R; interleukin 4 receptor; CD124; IL4RA; IL-4RA; interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL4R nirs variant 1; interleukin 13 receptor; interleukin-4 receptor alpha chain |
Gene ID | 3566 |
mRNA Refseq | NM_000418 |
Protein Refseq | NP_000409 |
MIM | 147781 |
UniProt ID | P24394 |
◆ Recombinant Proteins | ||
Il4r-2131R | Recombinant Rat Il4r protein, His-tagged | +Inquiry |
Il4r-379R | Active Recombinant Rat Il4r protein, hFc-tagged | +Inquiry |
IL4R-18C | Active Recombinant Cynomolgus IL4R protein, His-tagged | +Inquiry |
IL4R-331H | Recombinant Human IL4R Protein, His-tagged | +Inquiry |
IL4R-330C | Recombinant Cynomolgus monkey IL4R Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *
0
Inquiry Basket