Active Recombinant Human IL4R Protein

Cat.No. : IL4R-01H
Product Overview : CHO cell-derived Recombinant Human sIL-4 Receptor α corresponding to 209 amino acid residues of the extracellular domain of IL-4Rα without tag was expressed inn CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Polymorphisms in this gene are also associated with resistance to human immunodeficiency virus type-1 infection. Alternate splicing results in multiple transcript variants.
Bio-activity : The ED50 was determined by its ability to inhibit the IL-4 dependent proliferation of human TF-1 cells is ≤ 5.0 ng/mL (in the presence of 0.5 ng/mL of IL-4), corresponding to a specific activity of ≥ 2 × 10^5 units/mg.
Molecular Mass : 23.9 kDa
AA Sequence : GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Purity : ≥ 95% by SDS-PAGE gel and HPLC analyses.
Gene Name IL4R interleukin 4 receptor [ Homo sapiens (human) ]
Official Symbol IL4R
Synonyms IL4R; interleukin 4 receptor; CD124; IL4RA; IL-4RA; interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL4R nirs variant 1; interleukin 13 receptor; interleukin-4 receptor alpha chain
Gene ID 3566
mRNA Refseq NM_000418
Protein Refseq NP_000409
MIM 147781
UniProt ID P24394

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL4R Products

Required fields are marked with *

My Review for All IL4R Products

Required fields are marked with *

0
cart-icon
0
compare icon