"NFKBIB" Related Products

Expand
Expand
Expand

Recombinant Human NFKBIB, His-tagged

Cat.No.: NFKBIB-28874TH
Product Overview: Recombinant fragment, corresponding to amino acids 9-356 of Human IKB beta, with a N-terminal His tag, 50kDa,
Description: The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B, which translocates to the nucleus to function as a transcription factor. Alternatively spliced transcript variants have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed in all tissues examined.
Form: Lyophilised:reconstitution with 124 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAP LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEY MDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAE RRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQ GPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEA ENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPL GSAMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSD SGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV
Sequence Similarities: Belongs to the NF-kappa-B inhibitor family.Contains 6 ANK repeats.
Gene Name: NFKBIB nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta [ Homo sapiens ]
Official Symbol: NFKBIB
Synonyms: NFKBIB; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta; NF-kappa-B inhibitor beta; IKBB; TRIP9;
Gene ID: 4793
mRNA Refseq: NM_001243116
Protein Refseq: NP_001230045
MIM: 604495
Uniprot ID: Q15653
Chromosome Location: 19q13.1
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem;
Function: protein binding; signal transducer activity; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.