Recombinant Human NFKBIB, His-tagged
| Cat.No. : | NFKBIB-28874TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 9-356 of Human IKB beta, with a N-terminal His tag, 50kDa, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 9-356 a.a. |
| Description : | The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B, which translocates to the nucleus to function as a transcription factor. Alternatively spliced transcript variants have been found for this gene. |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in all tissues examined. |
| Form : | Lyophilised:reconstitution with 124 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAP LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEY MDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAE RRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQ GPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEA ENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPL GSAMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSD SGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV |
| Sequence Similarities : | Belongs to the NF-kappa-B inhibitor family.Contains 6 ANK repeats. |
| Gene Name | NFKBIB nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta [ Homo sapiens ] |
| Official Symbol | NFKBIB |
| Synonyms | NFKBIB; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta; NF-kappa-B inhibitor beta; IKBB; TRIP9; |
| Gene ID | 4793 |
| mRNA Refseq | NM_001243116 |
| Protein Refseq | NP_001230045 |
| MIM | 604495 |
| Uniprot ID | Q15653 |
| Chromosome Location | 19q13.1 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; |
| Function | protein binding; signal transducer activity; transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| NFKBIB-9065H | Recombinant Human NFKBIB protein | +Inquiry |
| Nfkbib-1877M | Recombinant Mouse Nfkbib protein, His & T7-tagged | +Inquiry |
| NFKBIB-7047Z | Recombinant Zebrafish NFKBIB | +Inquiry |
| NFKBIB-6040M | Recombinant Mouse NFKBIB Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFKBIB-5974H | Recombinant Human NFKBIB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFKBIB-3849HCL | Recombinant Human NFKBIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKBIB Products
Required fields are marked with *
My Review for All NFKBIB Products
Required fields are marked with *
