"PDE4A" Related Products

Expand
Expand

Recombinant Human PDE4A

Cat.No.: PDE4A-29933TH
Product Overview: Recombinant full length Human PDE4A, isoform 4 with N terminal proprietary tag. Predicted MW 97.24 kDa.
Description: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein length: 647 amino acids
Molecular Weight: 97.240kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchial smooth muscle. Iso
Form: Liquid
Purity: Proprietary Purification
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRS GNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPS QPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKT DQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIF QERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAA DVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPG VSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNC DIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTM VETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPL ELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVE KSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWY YSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEE EISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQE SLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSR EEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGL PSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGG GSGGDPT
Sequence Similarities: Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
Gene Name: PDE4A phosphodiesterase 4A, cAMP-specific [ Homo sapiens ]
Official Symbol: PDE4A
Synonyms: PDE4A; phosphodiesterase 4A, cAMP-specific; DPDE2, phosphodiesterase 4A, cAMP specific (dunce (Drosophila) homolog phosphodiesterase E2); cAMP-specific 3,5-cyclic phosphodiesterase 4A; phosphodiesterase E2 dunce homolog (Drosophila);
Gene ID: 5141
mRNA Refseq: NM_001111307
Protein Refseq: NP_001104777
MIM: 600126
Uniprot ID: P27815
Chromosome Location: 19p13.2
Pathway: DARPP-32 events, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Opioid Signalling, organism-specific biosystem;
Function: 3,5-cyclic-AMP phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.