Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human PDE4A

Cat.No. : PDE4A-29933TH
Product Overview : Recombinant full length Human PDE4A, isoform 4 with N terminal proprietary tag. Predicted MW 97.24 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein length : 647 amino acids
Molecular Weight : 97.240kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Isoform 1 is widely expressed. Isoform 2 is abundant in liver, stomach, testis, thyroid and adrenal glands. It is also found in placenta, kidney, pancreas, ovary, uterus, skin, monocytes, mast cells, macrophages, as well as in bronchial smooth muscle. Iso
Form : Liquid
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPLVDFFCETCSKPWLVGWWDQFKRMLNRELTHLSEMSRS GNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPS QPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKT DQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIF QERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAA DVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPG VSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNC DIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTM VETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPL ELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVE KSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWY YSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEE EISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQE SLEVMAQEASLEAELEAVYLTQQAQSTGSAPVAPDEFSSR EEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGL PSTAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGG GSGGDPT
Sequence Similarities : Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
Tag : Non
Gene Name : PDE4A phosphodiesterase 4A, cAMP-specific [ Homo sapiens ]
Official Symbol : PDE4A
Synonyms : PDE4A; phosphodiesterase 4A, cAMP-specific; DPDE2, phosphodiesterase 4A, cAMP specific (dunce (Drosophila) homolog phosphodiesterase E2); cAMP-specific 3,5-cyclic phosphodiesterase 4A; phosphodiesterase E2 dunce homolog (Drosophila);
Gene ID : 5141
mRNA Refseq : NM_001111307
Protein Refseq : NP_001104777
MIM : 600126
Uniprot ID : P27815
Chromosome Location : 19p13.2
Pathway : DARPP-32 events, organism-specific biosystem; G Protein Signaling Pathways, organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Opioid Signalling, organism-specific biosystem;
Function : 3,5-cyclic-AMP phosphodiesterase activity; hydrolase activity; metal ion binding; phosphoric diester hydrolase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
12/05/2022

    PDE4A requires less storage environment.

    07/26/2022

      The expression of PDE4A was stable.

      02/08/2022

        It has the advantage of easy operation in the expression system and can improve the expression efficiency.

        Q&As (6)

        Ask a question
        How effective are PDE4A inhibitors in the treatment of asthma? 04/12/2022

        The inhibitors have been used in the treatment of asthma, and studies have shown that they can significantly reduce the number of asthma attacks and the use of drug D.

        How to introduce the structure of PDE4A? 03/30/2022

        This protein has multiple conserved regions and different subtypes, which is of great significance for the selective inhibition of drugs.

        What is a selective PDE4A inhibitor? 12/25/2021

        Selective PDE4A inhibitors refer to drug molecules that target only the PDE4A protein and do not inhibit other PDE4 homologs.

        What is the mechanism by which PDE4A regulates T cell-mediated autoimmune responses? 05/30/2021

        It plays an important role in the activation and regulation of T cells by regulating cAMP levels, and is involved in T cell-mediated autoimmune responses.

        Are levels of PDE4A associated with sleep disturbances? 02/12/2021

        Studies have shown that PDE4A depletion may be related to sleep-wake behavior and time stress response, but its specific role needs to be further studied.

        What is the expression pattern of PDE4A in T cells? 08/27/2020

        In T cells, PDE4A is mainly expressed in the cytoplasm and peripheral regions of the nuclear membrane.

        Ask a Question for All PDE4A Products

        Required fields are marked with *

        My Review for All PDE4A Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends