"S100B" Related Products

Expand
Expand

Recombinant Human S100B, His-tagged

Cat.No.: S100B-31010TH
Product Overview: Recombinant full lenght processed protein corresponding to amino acids 2-92 of Human S100 beta, with N terminal His tag
Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimers disease, Downs syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes.
Conjugation: HIS
Source: E. coli
Tissue specificity: Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Sequence Similarities: Belongs to the S-101 family.Contains 2 EF-hand domains.
Gene Name: S100B S100 calcium binding protein B [ Homo sapiens ]
Official Symbol: S100B
Synonyms: S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta;
Gene ID: 6285
mRNA Refseq: NM_006272
Protein Refseq: NP_006263
MIM: 176990
Uniprot ID: P04271
Chromosome Location: 21q22.3
Pathway: Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem;
Function: RAGE receptor binding; S100 beta binding; calcium ion binding; calcium-dependent protein binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.