"SERPINB8" Related Products

Expand
Expand

Recombinant Human SERPINB8

Cat.No.: SERPINB8-31160TH
Product Overview: Recombinant full length Human SerpinB8 with a N terminal proprietary tag: predicted MW 52.73 kDa.
Description: The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration.
Protein length: 242 amino acids
Molecular Weight: 52.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALA MVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRT GTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELS FAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLV LVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV KE
Sequence Similarities: Belongs to the serpin family. Ov-serpin subfamily.
Gene Name: SERPINB8 serpin peptidase inhibitor, clade B (ovalbumin), member 8 [ Homo sapiens ]
Official Symbol: SERPINB8
Synonyms: SERPINB8; serpin peptidase inhibitor, clade B (ovalbumin), member 8; PI8, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; serpin B8; CAP2; cytoplasmic antiproteinase 2;
Gene ID: 5271
mRNA Refseq: NM_001031848
Protein Refseq: NP_001027018
MIM: 601697
Uniprot ID: P50452
Chromosome Location: 18q21.3
Function: peptidase inhibitor activity; protein binding; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.