"PG" Related Products

Recombinant Human Prostate Specific Gene-1

Cat. No.: PG-54H
Product Overview: Recombinant HPG-1 is a 16 kDa recombinant fusion protein consisting of 127 amino acid residues of the human HPG-1 and 9 additional amino acid residues of the His-Tag (underlined). MKHHHHHHHMIKKNLKKLGIEETYLNIIKAIYDRPTASIQKTENLSTKTGTSQEYHLSPLWFYIVLEILASTIRQEKNLKDIHTEKEEVK LSLFADAMILYLKKPNDSTR KLLELIKKIHSSCRIKINIH FAFCSQ
Description: Human Prostate-Specific Gene-1 (HPG-1) product is a recently discovered membrane-anchored protein of approximately 15 kD. It was detected exclusively in the prostate (19 different tissues were tested). Antisense-oligonicleotide inhibition of HPG-1 expression inhibited the growth of one prostate cancer cell line (LNCaP) significantly (86%). HPG-1 might be a novel diagnostic and/or therapeutic target.
Synonyms: HPG-1; Prostate Specific Gene-1; PG.
Source: E.coli
Purity: >95% (SDS-PAGE analyzed).
Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05 M MES buffer pH6.5
Reconstitution: Add 0.2 ml of dH2O and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited.
Specificity: The amino acid sequence of the recombinant HPG-1 is 100% homologous to the amino acid sequence of the human HPG-1.
Purification Method: Ni-NTA affinity chromatography
Applications: Western blotting, ELISA
Storage: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.