Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human Prostate Specific Gene-1

Cat.No. : PG-54H
Product Overview : Recombinant HPG-1 is a 16 kDa recombinant fusion protein consisting of 127 amino acid residues of the human HPG-1 and 9 additional amino acid residues of the His-Tag (underlined). MKHHHHHHHMIKKNLKKLGIEETYLNIIKAIYDRPTASIQKTENLSTKTGTSQEYHLSPLWFYIVLEILASTIRQEKNLKDIHTEKEEVK LSLFADAMILYLKKPNDSTR KLLELIKKIHSSCRIKINIH FAFCSQ
  • Specification
  • Gene Information
  • Related Products
Cat. No. : PG-54H
Description : Human Prostate-Specific Gene-1 (HPG-1) product is a recently discovered membrane-anchored protein of approximately 15 kD. It was detected exclusively in the prostate (19 different tissues were tested). Antisense-oligonicleotide inhibition of HPG-1 expression inhibited the growth of one prostate cancer cell line (LNCaP) significantly (86%). HPG-1 might be a novel diagnostic and/or therapeutic target.
Source : E.coli
Purity : >95% (SDS-PAGE analyzed).
Formulation : Sterile filtered and lyophilized from 0.5 mg/ml in 0.05 M MES buffer pH6.5
Reconstitution : Add 0.2 ml of dH2O and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited.
Specificity : The amino acid sequence of the recombinant HPG-1 is 100% homologous to the amino acid sequence of the human HPG-1.
Purification Method : Ni-NTA affinity chromatography
Applications : Western blotting, ELISA
Storage : Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time.
Synonyms : HPG-1; Prostate Specific Gene-1; PG.
Synonyms : HPG-1; Prostate Specific Gene-1; PG.

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends