"SAA1" Related Products

Expand
Expand
Expand

Recombinant Human SAA1 protein

Cat.No. : SAA1-2668H
Product Overview : Recombinant Human SAA1 protein was expressed in Escherichia coli.
Description : Serum amyloid A protein which belongs to the SAA family is encoded by the SAA gene in humans. It is expressed by the liver and secreted in plasma. Serum amyloid A is the major acute phase reactant and apolipoprotein of the HDL complex. Elevated serum SAA protein levels may be associated with lung cancer. The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL Apo-lipoprotein. Recombinant human Apo-SAA1 is an 11.7 kDa protein containing 104 amino acid residues.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 9.0, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemoattract bioassay using human monocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
Protein length : 104
AA Sequence : RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : SAA1
Official Symbol : SAA1
Synonyms : SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216;
Gene ID : 6288
mRNA Refseq : NM_000331
Protein Refseq : NP_000322
MIM : 104750
UniProt ID : P0DJI8

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.