"IL18" Related Products

Expand
Expand
Expand

GMP Recombinant Human IL18 Protein

Cat.No.: IL18-153HG
Product Overview: Recombinant Human IL18 (Tyr37-Asp193) with a 6His tag at the C-terminus was produced in HEK293 cell in an animal component free process under cGMP guidelines.
Description: Interleukin-18 is a secreted protein and it belongs to the IL-1 family. IL-18 is a proinflammatory cytokine and produced by macrophages and other cells. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells.
Source: HEK293 cell
Species: Human
Tag : His
Form: Lyophilized.
Bio-activity: Measured by its ability to induce NFKB reporter gene expression in HEK 293 cell line.
The ED50 for this effect is typically 25.3 ng/mL.
AA Sequence: YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTIS VKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKE RDLFKLILKKEDELGDRSIMFTVQNEDVDHHHHHH
Residual Host Cell DNA Content: <10pg/mg
Residual Host Cell Protein Content: <1ug/mg
Endotoxin: <0.1EU/ug
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration >100μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL18 interleukin 18 (interferon-gamma-inducing factor) [ Homo sapiens ]
Official Symbol: IL18
Synonyms: IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IGIF; IL 1g; IL 18; IL1F4; IL-1 gamma; iboctadekin; interleukin-1 gamma; IFN-gamma-inducing factor; IL-18; IL-1g
Gene ID: 3606
mRNA Refseq: NM_001243211
Protein Refseq: NP_001230140
MIM: 600953
UniProt ID: Q14116

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.