Recombinant Active Human FGF23 Protein, His-tagged(C-ter)
Cat.No. : | FGF23-83H |
Product Overview : | Recombinant Active Human FGF23 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with human FGFRIIIc. The ED50 for this effect is < 0.3 μg/mL. |
AA Sequence : | MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens ] |
Official Symbol | FGF23 |
Synonyms | FGF23; fibroblast growth factor 23; |
Gene ID | 53406 |
◆ Recombinant Proteins | ||
Fgf23-2998M | Recombinant Mouse Fgf23 Protein, Myc/DDK-tagged | +Inquiry |
FGF23-1113HFL | Recombinant Full Length Human FGF23 Protein, C-Flag-tagged | +Inquiry |
FGF23-3586H | Recombinant Human FGF23 Full Length Protein, His tagged | +Inquiry |
FGF23-1013H | Recombinant Human FGF23 Protein (Y25-R179), Tag Free | +Inquiry |
FGF23-3431H | Recombinant Human FGF23 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket