Recombinant Bovine BGLAP protein, His-KSI-tagged

• Cat.No.: BGLAP-4574B
• Product Overview: Recombinant Bovine BGLAP protein(P02820)(52-100 aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&KSI
• Protein Length: 52-100 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 21.0 kDa
• AASequence: YLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.