Recombinant Human BGLAP Protein, GST-tagged

• Cat.No.: BGLAP-205H
• Product Overview: Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 31.13 kDa
• AA Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ]
• Official Symbol: BGLAP
• Synonyms: BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP
• Gene ID: 632
• mRNA Refseq: NM_199173
• Protein Refseq: NP_954642
• MIM: 112260
• UniProt ID: P02818