Recombinant Human BGLAP Protein, GST-tagged
| Cat.No. : | BGLAP-205H |
| Product Overview : | Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 31.13 kDa |
| AA Sequence : | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ] |
| Official Symbol | BGLAP |
| Synonyms | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP; |
| Gene ID | 632 |
| mRNA Refseq | NM_199173 |
| Protein Refseq | NP_954642 |
| MIM | 112260 |
| UniProt ID | P02818 |
| ◆ Recombinant Proteins | ||
| BGLAP-1263P | Recombinant Pig BGLAP Protein, His&GST-tagged | +Inquiry |
| BGLAP-1473H | Recombinant Human BGLAP, His-tagged | +Inquiry |
| BGLAP-634R | Recombinant Rat BGLAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Bglap-1143R | Recombinant Rat Bglap Protein, GST-tagged | +Inquiry |
| BGLAP-976R | Recombinant Rat BGLAP Protein | +Inquiry |
| ◆ Native Proteins | ||
| BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
| BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
| BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
| BGLAP-57H | Native Human Osteocalcin | +Inquiry |
| BGLAP-60H | Native Human BGLAP protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
