Recombinant Human BGLAP Protein, GST-tagged

Cat.No. : BGLAP-205H
Product Overview : Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 31.13 kDa
AA Sequence : YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ]
Official Symbol BGLAP
Synonyms BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP;
Gene ID 632
mRNA Refseq NM_199173
Protein Refseq NP_954642
MIM 112260
UniProt ID P02818

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BGLAP Products

Required fields are marked with *

My Review for All BGLAP Products

Required fields are marked with *

0
cart-icon
0
compare icon