Recombinant Human BGLAP Protein, GST-tagged
Cat.No. : | BGLAP-205H |
Product Overview : | Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 31.13 kDa |
AA Sequence : | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ] |
Official Symbol : | BGLAP |
Synonyms : | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP; |
Gene ID : | 632 |
mRNA Refseq : | NM_199173 |
Protein Refseq : | NP_954642 |
MIM : | 112260 |
UniProt ID : | P02818 |
Products Types
◆ Recombinant Protein | ||
Bglap-1143R | Recombinant Rat Bglap Protein, GST-tagged | +Inquiry |
Bglap-1262M | Recombinant Mouse Bglap Protein, His-tagged | +Inquiry |
BGLAP-364R | Recombinant Rhesus Macaque BGLAP Protein, His (Fc)-Avi-tagged | +Inquiry |
BGLAP-010H | Recombinant Human BGLAP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
BGLAP-2141H | Recombinant Human BGLAP Protein, His-tagged | +Inquiry |
◆ Native Protein | ||
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionCustomer Reviews (3)
Write a reviewThis assurance enables me to confidently utilize the BGLAP protein in my research, knowing that it will consistently deliver reliable and accurate results.
The manufacturer plays a crucial role in supporting my research with their extensive expertise and resources.
By using BGLAP protein, I can gain insights into the underlying molecular processes contributing to amyloidosis, which can ultimately aid in the development of novel therapeutic strategies.
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
Inquiry Basket