Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human BGLAP Protein, GST-tagged

Cat.No. : BGLAP-205H
Product Overview : Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 31.13 kDa
AA Sequence : YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ]
Official Symbol : BGLAP
Synonyms : BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP;
Gene ID : 632
mRNA Refseq : NM_199173
Protein Refseq : NP_954642
MIM : 112260
UniProt ID : P02818

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (3)

Write a review
Reviews
06/03/2019

    This assurance enables me to confidently utilize the BGLAP protein in my research, knowing that it will consistently deliver reliable and accurate results.

    05/13/2017

      The manufacturer plays a crucial role in supporting my research with their extensive expertise and resources.

      02/18/2017

        By using BGLAP protein, I can gain insights into the underlying molecular processes contributing to amyloidosis, which can ultimately aid in the development of novel therapeutic strategies.

        Ask a Question for All BGLAP Products

        Required fields are marked with *

        My Review for All BGLAP Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends