Recombinant Human BGLAP Protein, GST-tagged
Cat.No. : | BGLAP-205H |
Product Overview : | Human BGLAP partial ORF ( NP_954642, 52 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 31.13 kDa |
AA Sequence : | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ] |
Official Symbol | BGLAP |
Synonyms | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP; |
Gene ID | 632 |
mRNA Refseq | NM_199173 |
Protein Refseq | NP_954642 |
MIM | 112260 |
UniProt ID | P02818 |
◆ Recombinant Proteins | ||
BGLAP-154H | Recombinant Human BGLAP | +Inquiry |
BGLAP-1473H | Recombinant Human BGLAP, His-tagged | +Inquiry |
BGLAP-6939C | Recombinant Chicken BGLAP | +Inquiry |
BGLAP-204H | Recombinant Human BGLAP Protein, His-Flag-tagged | +Inquiry |
Bglap-16R | Recombinant Rat Bglap protein, His-GST-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
0
Inquiry Basket