Recombinant Clostridium Botulinum CLPP Protein (1-194 aa), His-SUMO-tagged
Cat.No. : | CLPP-1971C |
Product Overview : | Recombinant Clostridium Botulinum (strain Hall/ATCC 3502/NCTC 13319/Type A) CLPP Protein (1-194 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Botulinum |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-194 aa |
Description : | Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | clpP ATP-dependent Clp protease proteolytic subunit [ Clostridium botulinum A str. ATCC 3502 ] |
Official Symbol | CLPP |
Synonyms | clpP; Endopeptidase Clp; |
Gene ID | 5187372 |
Protein Refseq | YP_001255721 |
UniProt ID | A5I6W1 |
◆ Recombinant Proteins | ||
CLPP-0016S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 CLPP protein, His-tagged | +Inquiry |
CLPP-937S | Recombinant Streptomyces coelicolor A3(2) CLPP protein, His-tagged | +Inquiry |
CLPP-1971C | Recombinant Clostridium Botulinum CLPP Protein (1-194 aa), His-SUMO-tagged | +Inquiry |
CLPP-11343H | Recombinant Human CLPP, GST-tagged | +Inquiry |
CLPP-1512H | Recombinant Human CLPP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLPP Products
Required fields are marked with *
My Review for All CLPP Products
Required fields are marked with *
0
Inquiry Basket