Recombinant Clostridium Botulinum CLPP Protein (1-194 aa), His-SUMO-tagged

Cat.No. : CLPP-1971C
Product Overview : Recombinant Clostridium Botulinum (strain Hall/ATCC 3502/NCTC 13319/Type A) CLPP Protein (1-194 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Clostridium Botulinum
Source : E.coli
Tag : His&SUMO
Protein Length : 1-194 aa
Description : Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.5 kDa
AA Sequence : MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name clpP ATP-dependent Clp protease proteolytic subunit [ Clostridium botulinum A str. ATCC 3502 ]
Official Symbol CLPP
Synonyms clpP; Endopeptidase Clp;
Gene ID 5187372
Protein Refseq YP_001255721
UniProt ID A5I6W1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLPP Products

Required fields are marked with *

My Review for All CLPP Products

Required fields are marked with *

0
cart-icon