Recombinant Clostridium Botulinum CLPP Protein (1-194 aa), His-SUMO-tagged

• Cat.No.: CLPP-1971C
• Product Overview: Recombinant Clostridium Botulinum (strain Hall/ATCC 3502/NCTC 13319/Type A) CLPP Protein (1-194 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.

Specification

• Species: Clostridium Botulinum
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-194 aa
• Description: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.5 kDa
• AA Sequence: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: clpP ATP-dependent Clp protease proteolytic subunit [ Clostridium botulinum A str. ATCC 3502 ]
• Official Symbol: CLPP
• Synonyms: clpP; Endopeptidase Clp
• Gene ID: 5187372
• Protein Refseq: YP_001255721
• UniProt ID: A5I6W1