"IL17A" Related Products

Expand
Expand

Recombinant Cynomolgus Monkey IL17A Protein

Cat.No. : IL17A-001C
Product Overview : Recombinant cynomolgus monkey IL17A protein without tag was produced in yeast.
Description : IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. Il-17 induces the production of many other cytokines (IL-6, G-CSF, GM-CSF, IL-1beta, TGF-beta, and TNF-alpha), chemokines, including IL-8 (CXCL8), GRO-alpha (CXCL1) and MCP-1 (CCL2) and prostaglandins from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages).
Source : Yeast
Species : Cynomolgus monkey
Molecular Mass : 15.1 kDa
AA Sequence : GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Applications : Cell culture, ELISA Standard, Western Blot Control
Gene Name : IL17A interleukin 17A [ Macaca mulatta (Rhesus monkey) ]
Official Symbol : IL17A
Synonyms : IL17A; interleukin 17A; interleukin-17A
Gene ID : 708123
mRNA Refseq : XM_001106391
Protein Refseq : XP_001106391
UniProt ID : F6T3G5

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.