Recombinant Cynomolgus Monkey IL17A Protein
Cat.No. : | IL17A-001C |
Product Overview : | Recombinant cynomolgus monkey IL17A protein without tag was produced in yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | Yeast |
Tag : | Non |
Description : | IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. Il-17 induces the production of many other cytokines (IL-6, G-CSF, GM-CSF, IL-1beta, TGF-beta, and TNF-alpha), chemokines, including IL-8 (CXCL8), GRO-alpha (CXCL1) and MCP-1 (CCL2) and prostaglandins from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages). |
Molecular Mass : | 15.1 kDa |
AA Sequence : | GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Applications : | Cell culture, ELISA Standard, Western Blot Control |
Gene Name | IL17A interleukin 17A [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; interleukin-17A |
Gene ID | 708123 |
mRNA Refseq | XM_001106391 |
Protein Refseq | XP_001106391 |
UniProt ID | F6T3G5 |
◆ Recombinant Proteins | ||
IL17A-12C | Active Recombinant Canine interleukin 17A protein, His tagged | +Inquiry |
IL17A-28212TH | Recombinant Human IL17A, Fc-tagged | +Inquiry |
IL17A-279H | Recombinant Human Interleukin 17A, Fc Chimera | +Inquiry |
Il17a-871R | Recombinant Rat Il17a protein, His-tagged | +Inquiry |
IL17A-2293H | Recombinant Human IL17A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *