Recombinant Cynomolgus Monkey IL17A Protein

Cat.No. : IL17A-001C
Product Overview : Recombinant cynomolgus monkey IL17A protein without tag was produced in yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : Yeast
Tag : Non
Description : IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. Il-17 induces the production of many other cytokines (IL-6, G-CSF, GM-CSF, IL-1beta, TGF-beta, and TNF-alpha), chemokines, including IL-8 (CXCL8), GRO-alpha (CXCL1) and MCP-1 (CCL2) and prostaglandins from many cell types (fibroblasts, endothelial cells, epithelial cells, keratinocytes and macrophages).
Molecular Mass : 15.1 kDa
AA Sequence : GIAIPRNSGCPNSEDKNFPRTVMVNLNIHNRNTSTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVKADGNVDYHMNSVPIQQEILVLREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Applications : Cell culture, ELISA Standard, Western Blot Control
Gene Name IL17A interleukin 17A [ Macaca mulatta (Rhesus monkey) ]
Official Symbol IL17A
Synonyms IL17A; interleukin 17A; interleukin-17A
Gene ID 708123
mRNA Refseq XM_001106391
Protein Refseq XP_001106391
UniProt ID F6T3G5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0
cart-icon