Recombinant Full Length Arabidopsis Thaliana Casparian Strip Membrane Protein 4(Casp4) Protein, His-Tagged
Cat.No. : | RFL36001AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Casparian strip membrane protein 4(CASP4) Protein (Q9FFZ7) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAA ATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAV APRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVS AFASVTFLAILVVISGVSLKRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CASP4 |
Synonyms | CASP4; At5g06200; MBL20.8; Casparian strip membrane protein 4; AtCASP4 |
UniProt ID | Q9FFZ7 |
◆ Recombinant Proteins | ||
CASP4-921HFL | Recombinant Full Length Human CASP4 Protein, N-His-tagged | +Inquiry |
CASP4-2594H | Recombinant Human CASP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP4-1244M | Recombinant Mouse CASP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP4-462R | Recombinant Rhesus Macaque CASP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP4-0424H | Recombinant Human CASP4 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP4-7836HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
CASP4-7837HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP4 Products
Required fields are marked with *
My Review for All CASP4 Products
Required fields are marked with *