Recombinant Full Length Human CNTF Protein, GST-tagged
| Cat.No. : | CNTF-1966HF |
| Product Overview : | Human CNTF full-length ORF ( NP_000605.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 200 amino acids |
| Description : | The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010] |
| Molecular Mass : | 49.3 kDa |
| AA Sequence : | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens ] |
| Official Symbol | CNTF |
| Synonyms | CNTF; ciliary neurotrophic factor; HCNTF |
| Gene ID | 1270 |
| mRNA Refseq | NM_000614 |
| Protein Refseq | NP_000605 |
| MIM | 118945 |
| UniProt ID | P26441 |
| ◆ Recombinant Proteins | ||
| CNTF-2013H | Recombinant Human CNTF Protein, His-tagged | +Inquiry |
| CNTF-26841TH | Recombinant Human CNTF | +Inquiry |
| CNTF-36H | Recombinant Human CNTF protein | +Inquiry |
| CNTF-261H | Recombinant Full Length Human ciliary neurotrophic factor Protein, Tag Free | +Inquiry |
| CNTF-3229M | Recombinant Mouse CNTF protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CNTF-26839TH | Native Human CNTF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *



