Recombinant Full Length Human CNTF Protein, GST-tagged
Cat.No. : | CNTF-1966HF |
Product Overview : | Human CNTF full-length ORF ( NP_000605.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 200 amino acids |
Description : | The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010] |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens ] |
Official Symbol | CNTF |
Synonyms | CNTF; ciliary neurotrophic factor; HCNTF |
Gene ID | 1270 |
mRNA Refseq | NM_000614 |
Protein Refseq | NP_000605 |
MIM | 118945 |
UniProt ID | P26441 |
◆ Recombinant Proteins | ||
CNTF-148H | Recombinant Human CNTF Protein | +Inquiry |
Cntf-296R | Recombinant Rat Ciliary Neurotrophic Factor | +Inquiry |
CNTF-566H | Active Recombinant Human CNTF protein, His-tagged | +Inquiry |
Cntf-159R | Recombinant Rat Cntf protein, His/S-tagged | +Inquiry |
CNTF-08H | Recombinant Human Ciliary Neurotrophic Factor, His-tagged | +Inquiry |
◆ Native Proteins | ||
CNTF-26839TH | Native Human CNTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *