Recombinant Full Length Human FGF23 Protein, C-Flag-tagged
Cat.No. : | FGF23-1113HFL |
Product Overview : | Recombinant Full Length Human FGF23 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens (human) ] |
Official Symbol | FGF23 |
Synonyms | ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC |
Gene ID | 8074 |
mRNA Refseq | NM_020638.3 |
Protein Refseq | NP_065689.1 |
MIM | 605380 |
UniProt ID | Q9GZV9 |
◆ Recombinant Proteins | ||
FGF23-1113HFL | Recombinant Full Length Human FGF23 Protein, C-Flag-tagged | +Inquiry |
FGF23-1699R | Recombinant Rhesus monkey FGF23 Protein, His-tagged | +Inquiry |
FGF23-1014H | Recombinant Human FGF23 Protein (Y25-R179), His tagged | +Inquiry |
FGF23-036H | Active Recombinant Human FGF23 Protein | +Inquiry |
Fgf23-835M | Recombinant Mouse Fgf23 protein(Tyr25~Val251), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *
0
Inquiry Basket