Recombinant Full Length Human SPN Protein, C-Flag-tagged
Cat.No. : | SPN-1075HFL |
Product Overview : | Recombinant Full Length Human SPN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular domain, a transmembrane region and a carboxy-terminal intracellular region. The extracellular domain has a high proportion of serine and threonine residues, allowing extensive O-glycosylation, and has one potential N-glycosylation site, while the carboxy-terminal region has potential phosphorylation sites that may mediate transduction of activation signals. Different glycoforms of this protein have been described. In stimulated immune cells, proteolytic cleavage of the extracellular domain occurs in some cell types, releasing a soluble extracellular fragment. Defects in expression of this gene are associated with Wiskott-Aldrich syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs) |
Full Length : | Full L. |
Gene Name | SPN sialophorin [ Homo sapiens (human) ] |
Official Symbol | SPN |
Synonyms | LSN; CD43; GALGP; GPL115; LEU-22 |
Gene ID | 6693 |
mRNA Refseq | NM_003123.6 |
Protein Refseq | NP_003114.1 |
MIM | 182160 |
UniProt ID | P16150 |
◆ Recombinant Proteins | ||
Spn-7035M | Recombinant Mouse Spn protein(Met1-Gly248), hFc-tagged | +Inquiry |
SPN-3246H | Recombinant Human SPN Protein, His-tagged | +Inquiry |
Spn-6565M | Recombinant Mouse Spn protein, His-tagged | +Inquiry |
RFL26763MF | Recombinant Full Length Mouse Leukosialin(Spn) Protein, His-Tagged | +Inquiry |
Spn-7035MAF488 | Recombinant Mouse Spn Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *
0
Inquiry Basket