Recombinant Full Length Xenopus Laevis Frizzled-4(Fzd4) Protein, His-Tagged
Cat.No. : | RFL34833XF |
Product Overview : | Recombinant Full Length Xenopus laevis Frizzled-4(fzd4) Protein (Q9PT62) (23-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-523) |
Form : | Lyophilized powder |
AA Sequence : | FGEEEERSCDPIRITMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQF FLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNH MCMEGPGDDEVPAHSKTPVLPGEDCNSFGPNSDQYTWVKRSMNCVLKCGYDSGLYNRLSK EFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVG RERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWG HEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLF TYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF YEVSNWNVFRYTADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQKCTNRLVNSGK VKRKKRVDGWVKPGKGNETVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fzd4 |
Synonyms | fzd4; fz4; Frizzled-4; Fz-4; Xfz4 |
UniProt ID | Q9PT62 |
◆ Recombinant Proteins | ||
FZD4-5200H | Recombinant Human FZD4 Protein (Met1-Glu180), C-His tagged | +Inquiry |
RFL24489GF | Recombinant Full Length Chicken Frizzled-4(Fzd4) Protein, His-Tagged | +Inquiry |
Fzd4-10558M | Recombinant Mouse Fzd4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27403HF | Recombinant Full Length Human Frizzled-4(Fzd4) Protein, His-Tagged | +Inquiry |
FZD4-2430R | Recombinant Rat FZD4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD4-1196RCL | Recombinant Rat FZD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fzd4 Products
Required fields are marked with *
My Review for All fzd4 Products
Required fields are marked with *
0
Inquiry Basket