Recombinant Human SAA1 protein, GST-tagged
| Cat.No. : | SAA1-2497H |
| Product Overview : | Recombinant Human SAA1 protein(1-122 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-122 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SAA1 serum amyloid A1 [ Homo sapiens ] |
| Official Symbol | SAA1 |
| Synonyms | SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4; tumor protein p53 inducible protein 4; SAA2; MGC111216; |
| Gene ID | 6288 |
| mRNA Refseq | NM_000331 |
| Protein Refseq | NP_000322 |
| MIM | 104750 |
| UniProt ID | P02735 |
| ◆ Recombinant Proteins | ||
| SAA1-6231H | Recombinant Human SAA1 Protein (Ser20-Tyr122), N-His tagged | +Inquiry |
| SAA1-15F | Recombinant Feline SAA1 Protein (1-111) | +Inquiry |
| SAA1-71M | Recombinant Full Length Mouse SAA1 Protein | +Inquiry |
| SAA1-5110H | Recombinant Human Serum Amyloid A1, His-tagged | +Inquiry |
| SAA1-1364D | Recombinant Dog SAA1 Protein, His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
| SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
