Recombinant Human AHR protein, His-tagged
Cat.No. : | AHR-9337H |
Product Overview : | Recombinant Human AHR protein(P35869)(220-420aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 220-420aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF |
Gene Name | AHR aryl hydrocarbon receptor [ Homo sapiens ] |
Official Symbol | AHR |
Synonyms | AHR; aryl hydrocarbon receptor; bHLHe76; AH-receptor; ah receptor; aromatic hydrocarbon receptor; class E basic helix-loop-helix protein 76; |
Gene ID | 196 |
mRNA Refseq | NM_001621 |
Protein Refseq | NP_001612 |
MIM | 600253 |
UniProt ID | P35869 |
◆ Recombinant Proteins | ||
AHR-120H | Recombinant Human AHR protein, His-tagged | +Inquiry |
AHR-405M | Recombinant Mouse AHR Protein, His (Fc)-Avi-tagged | +Inquiry |
AHR-1443M | Recombinant Mouse AHR Protein | +Inquiry |
Ahr-6846R | Recombinant Rat Ahr protein, His-tagged | +Inquiry |
AHR-109H | Recombinant Human Aryl hydrocarbon receptor LBD/Hsp90 complex, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHR-8962HCL | Recombinant Human AHR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHR Products
Required fields are marked with *
My Review for All AHR Products
Required fields are marked with *