Recombinant Human ATP2C1 protein, GST-tagged
| Cat.No. : | ATP2C1-974H |
| Product Overview : | Human ATP2C1 partial ORF ( AAH28139, 119 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium ions. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 42.35 kDa |
| AA Sequence : | VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP2C1 ATPase, Ca++ transporting, type 2C, member 1 [ Homo sapiens ] |
| Official Symbol | ATP2C1 |
| Synonyms | ATP2C1; ATPase, Ca++ transporting, type 2C, member 1; BCPM, benign chronic pemphigus (Hailey Hailey disease); calcium-transporting ATPase type 2C member 1; ATP2C1A; KIAA1347; PMR1; secretory pathway Ca2+/Mn2+ ATPase 1; SPCA1; HUSSY-28; ATPase 2C1; ATPase, Ca(2+)-sequestering; ATP-dependent Ca(2+) pump PMR1; HHD; BCPM; hSPCA1; |
| Gene ID | 27032 |
| mRNA Refseq | NM_001001485 |
| Protein Refseq | NP_001001485 |
| MIM | 604384 |
| UniProt ID | P98194 |
| ◆ Recombinant Proteins | ||
| ATP2C1-268H | Recombinant Human ATP2C1 Protein, His-tagged | +Inquiry |
| ATP2C1-281R | Recombinant Rhesus Macaque ATP2C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP2C1-452R | Recombinant Rhesus monkey ATP2C1 Protein, His-tagged | +Inquiry |
| ATP2C1-10012H | Recombinant Human ATP2C1, His-tagged | +Inquiry |
| ATP2C1-0816H | Recombinant Human ATP2C1 Protein (Met1-Pro70), N-GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP2C1-148HCL | Recombinant Human ATP2C1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP2C1 Products
Required fields are marked with *
My Review for All ATP2C1 Products
Required fields are marked with *
