Recombinant Human BGLAP protein, GST-tagged

• Cat.No.: BGLAP-1474H
• Product Overview: Recombinant Human BGLAP(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-100 a.a.
• Description: This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.4 kDa
• AA Sequence: MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCE LNPDCDELADHIGFQEAYRRFYGPV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ]
• Official Symbol: BGLAP
• Synonyms: BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP
• Gene ID: 632
• mRNA Refseq: NM_199173
• Protein Refseq: NP_954642
• MIM: 112260
• UniProt ID: P02818
• Chromosome Location: 1q25-q31
• Pathway: Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem
• Function: calcium ion binding; hydroxyapatite binding; structural constituent of bone; structural molecule activity