Recombinant Dog BGLAP protein, His-KSI-tagged

• Cat.No.: BGLAP-2588D
• Product Overview: Recombinant Dog BGLAP protein(P81455)(1-49aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Dog
• Tag: His-KSI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.9 kDa
• Protein length: 1-49aa
• AA Sequence: YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BGLAP bone gamma-carboxyglutamate (gla) protein [ Canis lupus familiaris ]
• Official Symbol: BGLAP
• Synonyms: BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone gamma-carboxyglutamate protein osteocalcin; bone gamma-carboxyglutamate (gla) protein (osteocalcin); GLA
• Gene ID: 403762