Recombinant Dog BGLAP protein, His-KSI-tagged
| Cat.No. : | BGLAP-2588D |
| Product Overview : | Recombinant Dog BGLAP protein(P81455)(1-49aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Dog |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 1-49aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.9 kDa |
| AA Sequence : | YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | BGLAP bone gamma-carboxyglutamate (gla) protein [ Canis lupus familiaris ] |
| Official Symbol | BGLAP |
| Synonyms | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone gamma-carboxyglutamate protein osteocalcin; bone gamma-carboxyglutamate (gla) protein (osteocalcin); GLA; |
| Gene ID | 403762 |
| ◆ Recombinant Proteins | ||
| BGLAP-1472H | Recombinant Human BGLAP protein, His/GST-tagged | +Inquiry |
| BGLAP-2543H | Recombinant Human BGLAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| BGLAP-010H | Recombinant Human BGLAP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BGLAP-706R | Recombinant Rabbit BGLAP Protein, His/GST-tagged | +Inquiry |
| BGLAP-536R | Recombinant Rhesus monkey BGLAP Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
| BGLAP-60H | Native Human BGLAP protein | +Inquiry |
| BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
| BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
| BGLAP-57H | Native Human Osteocalcin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
