Recombinant Dog BGLAP protein, His-KSI-tagged
Cat.No. : | BGLAP-2588D |
Product Overview : | Recombinant Dog BGLAP protein(P81455)(1-49aa), fused to N-terminal His tag and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-49aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BGLAP bone gamma-carboxyglutamate (gla) protein [ Canis lupus familiaris ] |
Official Symbol | BGLAP |
Synonyms | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone gamma-carboxyglutamate protein osteocalcin; bone gamma-carboxyglutamate (gla) protein (osteocalcin); GLA; |
Gene ID | 403762 |
◆ Recombinant Proteins | ||
BGLAP-364R | Recombinant Rhesus Macaque BGLAP Protein, His (Fc)-Avi-tagged | +Inquiry |
Bglap-18M | Recombinant Mouse Bglap protein, His/GST-tagged | +Inquiry |
BGLAP-154H | Recombinant Human BGLAP | +Inquiry |
BGLAP-976R | Recombinant Rat BGLAP Protein | +Inquiry |
BGLAP-702C | Recombinant Chicken BGLAP Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
0
Inquiry Basket