Recombinant Human CA6

Cat.No. : CA6-26443TH
Product Overview : Recombinant fragment of Human CA6 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Major constituent of saliva.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
Sequence Similarities : Belongs to the alpha-carbonic anhydrase family.
Gene Name CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol CA6
Synonyms CA6; carbonic anhydrase VI; carbonic anhydrase 6;
Gene ID 765
mRNA Refseq NM_001215
Protein Refseq NP_001206
MIM 114780
Uniprot ID P23280
Chromosome Location 1p36.2
Pathway Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA6 Products

Required fields are marked with *

My Review for All CA6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon