"S100A9" Related Products

Expand
Expand
Expand

Recombinant Human Calprotectin S100A9 Protein

Cat.No.: S100A9-1019H
Product Overview: Recombinant Human S100 calcium binding protein A9 antigen is produced by E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Predicted molecular weight: 13 kDa.
Antigen Description: Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment.
Description: Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment.
Source: E. coli
Species: Human
Form: Lyophilized
Bio-activity: Anti-h Calprotectin 3403: + Anti-h Calprotectin 3404: - Anti-h Calprotectin 3405: - Anti-h Calprotectin 3406: - Anti-h Calprotectin 3407: -
Molecular Mass: 13kDa
AA Sequence: TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDL DTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Purity: >90% by SDS-PAGE
Storage: -20centigrade
Concentration: 0.5 mg/ml when reconstituted with 1000 µl of deionized water
Storage Buffer: PBS, pH 7.4
Reconstitution: Reconstitute lyophilized protein with 1000 µl of deionized water
Gene Name: S100A9 S100 calcium binding protein A9 [ Homo sapiens ]
Official Symbol: S100A9
Synonyms: S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG;
Gene ID: 6280
mRNA Refseq: NM_002965
Protein Refseq: NP_002956
MIM: 123886
UniProt ID: P06702

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.