Recombinant Human CCL20 Protein

Cat.No. : CCL20-47H
Product Overview : Recombinant Human CCL20 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70 amino acid
Description : C-C motif chemokine 20 (CCL20), also known as liver activation regulated chemokine (LARC), Macrophage Inflammatory Protein-3 alpha (MIP-3 alpha), or Exodus, is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. CCL20 is a ligand for the G protein-coupled receptor CCR6, and induces chemotactic migration in a wide range of CCR6-expressing cells including immature dendritic cells (DC), effector/memory T-cells and B-cells. CCL20 is implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells towards the epithelial cells surrounding these tissues. CCL20 is expressed in the skin and contributes to the chronic inflammation of psoriasis.
Form : Lyophilized
Molecular Mass : 8.0255 kDa
AA Sequence : ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCAN PKQTWVKYIVRLLSKKVKNM
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 20
Gene Name CCL20 C-C motif chemokine ligand 20 [ Homo sapiens (human) ]
Official Symbol CCL20
Synonyms CKb4; LARC; ST38; MIP3A; Exodus; MIP-3a; SCYA20; MIP-3-alpha
Gene ID 6364
mRNA Refseq NM_004591
Protein Refseq NP_004582
MIM 601960
UniProt ID P78556

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL20 Products

Required fields are marked with *

My Review for All CCL20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon