Recombinant Human CD63 protein, His-tagged

Cat.No. : CD63-3584H
Product Overview : Recombinant Human CD63 protein(104-209 aa), fused to His tag, was expressed in E. coli.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 104-209 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CD63 CD63 molecule [ Homo sapiens ]
Official Symbol CD63
Synonyms CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H;
Gene ID 967
mRNA Refseq NM_001257389
Protein Refseq NP_001244318
MIM 155740
UniProt ID P08962

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD63 Products

Required fields are marked with *

My Review for All CD63 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon