Recombinant Human CD63 protein, His-tagged
Cat.No. : | CD63-3584H |
Product Overview : | Recombinant Human CD63 protein(104-209 aa), fused to His tag, was expressed in E. coli. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 104-209 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD63 CD63 molecule [ Homo sapiens ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
Gene ID | 967 |
mRNA Refseq | NM_001257389 |
Protein Refseq | NP_001244318 |
MIM | 155740 |
UniProt ID | P08962 |
◆ Recombinant Proteins | ||
CD63-747R | Recombinant Rhesus monkey CD63 Protein, His-tagged | +Inquiry |
Cd63-30R | Recombinant Rat Cd63, His tagged | +Inquiry |
RFL29403HF | Recombinant Full Length Human Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
RFL3211OF | Recombinant Full Length Rabbit Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-1261R | Recombinant Rat CD63 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *