Recombinant Human CHUK protein, His-tagged
| Cat.No. : | CHUK-3943H |
| Product Overview : | Recombinant Human CHUK protein(516 - 620 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 516 - 620 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHUK conserved helix-loop-helix ubiquitous kinase [ Homo sapiens ] |
| Official Symbol | CHUK |
| Synonyms | CHUK; conserved helix-loop-helix ubiquitous kinase; TCF16; inhibitor of nuclear factor kappa-B kinase subunit alpha; IkBKA; IKK alpha; IKK1; IKKA; NFKBIKA; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha; IKBKA; IKK-alpha; |
| Gene ID | 1147 |
| mRNA Refseq | NM_001278 |
| Protein Refseq | NP_001269 |
| MIM | 600664 |
| UniProt ID | O15111 |
| ◆ Recombinant Proteins | ||
| CHUK-2119C | Recombinant Chicken CHUK | +Inquiry |
| CHUK-1351H | Recombinant Human CHUK Protein, GST-tagged | +Inquiry |
| CHUK-27562TH | Recombinant Human CHUK | +Inquiry |
| CHUK-5129H | Active Recombinant Human CHUK Protein, GST-tagged | +Inquiry |
| CHUK-1004H | Recombinant Human Conserved Helix-Loop-Helix Ubiquitous Kinase, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHUK-111HKCL | Human CHUK Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHUK Products
Required fields are marked with *
My Review for All CHUK Products
Required fields are marked with *
