Recombinant Human CLDN2 protein(184-230 aa), GST-tagged
Cat.No. : | CLDN2-11292H |
Product Overview : | Recombinant Human CLDN2 protein(184-230 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Species : | Human |
Tag : | N-GST |
Protein length : | 184-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AASequence : | SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name : | CLDN2 claudin 2 [ Homo sapiens ] |
Official Symbol : | CLDN2 |
Synonyms : | CLDN2; claudin 2; claudin-2; SP82 |
Gene ID : | 9075 |
mRNA Refseq : | NM_001171092 |
Protein Refseq : | NP_001164563 |
MIM : | 300520 |
UniProt ID : | P57739 |
Products Types
◆ Recombinant Protein | ||
CLDN2-1438H | Recombinant Human CLDN2 Protein, GST-tagged | +Inquiry |
Cldn2-900M | Recombinant Mouse Cldn2 Protein, MYC/DDK-tagged | +Inquiry |
CLDN2-1282Z | Recombinant Zebrafish CLDN2 | +Inquiry |
CLDN2-5001C | Recombinant Chicken CLDN2 | +Inquiry |
CLDN2-0405H | Recombinant Human CLDN2 Protein (Met1-Val230), C-His-tagged | +Inquiry |
◆ Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionYes, there are ongoing clinical trials investigating the safety and efficacy of CLDN2-targeted therapies in various disease contexts, including cancer and inflammatory conditions.
No, CLDN2 expression varies among different cancer types, and its role may differ depending on the specific context of the disease.
Some studies suggest that elevated CLDN2 levels in certain cancers correlate with a poorer prognosis, making it a potential prognostic marker.
Modulating CLDN2 expression could help restore epithelial barrier function in the intestines, potentially offering a new avenue for the treatment of inflammatory bowel diseases.
The regulation of CLDN2 expression involves complex signaling pathways, and understanding these mechanisms is crucial for developing targeted therapies.
Customer Reviews (3)
Write a reviewIts superior binding affinity and specificity enable accurate and reliable detection of target analytes in various biological samples.
Its stability and well-defined structure make it an excellent candidate for visualizing and understanding the three-dimensional arrangement of proteins at a high resolution.
CLDN2 protein has proven to be instrumental in protein electron microscopy structure analysis.
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *
Inquiry Basket