Recombinant Human CLIC1 Protein, GST-tagged

• Cat.No.: CLIC1-1477H
• Product Overview: Human CLIC1 full-length ORF ( AAH64527.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
• Molecular Mass: 52.25 kDa
• AA Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLIC1 chloride intracellular channel 1 [ Homo sapiens ]
• Official Symbol: CLIC1
• Synonyms: CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6
• Gene ID: 1192
• mRNA Refseq: NM_001288
• Protein Refseq: NP_001279
• MIM: 602872
• UniProt ID: O00299