Recombinant Human CLIC1 Protein, GST-tagged

Cat.No. : CLIC1-1477H
Product Overview : Human CLIC1 full-length ORF ( AAH64527.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 52.25 kDa
AA Sequence : MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLIC1 chloride intracellular channel 1 [ Homo sapiens ]
Official Symbol CLIC1
Synonyms CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6;
Gene ID 1192
mRNA Refseq NM_001288
Protein Refseq NP_001279
MIM 602872
UniProt ID O00299

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIC1 Products

Required fields are marked with *

My Review for All CLIC1 Products

Required fields are marked with *

0
cart-icon