Recombinant Human CLIC1 Protein, GST-tagged
| Cat.No. : | CLIC1-1477H |
| Product Overview : | Human CLIC1 full-length ORF ( AAH64527.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 52.25 kDa |
| AA Sequence : | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLIC1 chloride intracellular channel 1 [ Homo sapiens ] |
| Official Symbol | CLIC1 |
| Synonyms | CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6; |
| Gene ID | 1192 |
| mRNA Refseq | NM_001288 |
| Protein Refseq | NP_001279 |
| MIM | 602872 |
| UniProt ID | O00299 |
| ◆ Recombinant Proteins | ||
| CLIC1-27814TH | Recombinant Human CLIC1, His-tagged | +Inquiry |
| CLIC1-620H | Recombinant Human CLIC1 Protein, His-tagged | +Inquiry |
| CLIC1-1747H | Recombinant Human CLIC1 Protein (Lys79-Lys241), His tagged | +Inquiry |
| RFL35442HF | Recombinant Full Length Human Chloride Intracellular Channel Protein 1(Clic1) Protein, His-Tagged | +Inquiry |
| Clic1-519M | Recombinant Mouse Clic1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLIC1-7448HCL | Recombinant Human CLIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC1 Products
Required fields are marked with *
My Review for All CLIC1 Products
Required fields are marked with *
