Recombinant Human CXCL16 protein, His-tagged
Cat.No. : | CXCL16-3096H |
Product Overview : | Recombinant Human CXCL16 protein(46-225 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 46-225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CXCL16 chemokine (C-X-C motif) ligand 16 [ Homo sapiens ] |
Official Symbol | CXCL16 |
Synonyms | CXCL16; chemokine (C-X-C motif) ligand 16; C-X-C motif chemokine 16; CXC chemokine ligand 16; CXCLG16; SR PSOX; SRPSOX; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX; |
Gene ID | 58191 |
mRNA Refseq | NM_001100812 |
Protein Refseq | NP_001094282 |
MIM | 605398 |
UniProt ID | Q9H2A7 |
◆ Recombinant Proteins | ||
Cxcl16-484M | Active Recombinant Mouse Chemokine (C-X-C motif) Ligand 16, His-tagged | +Inquiry |
CXCL16-2182H | Recombinant Human CXCL16 Protein (Pro49-Pro137), N-GST tagged | +Inquiry |
CXCL16-2179H | Recombinant Human CXCL16 Protein (Asn27-Trp201), C-His tagged | +Inquiry |
CXCL16-330H | Active Recombinant Human CXCL16, His-tagged | +Inquiry |
CXCL16-2286HF | Recombinant Full Length Human CXCL16 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL16-253C | Recombinant Cynomolgus CXCL16 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL16-1414RCL | Recombinant Rat CXCL16 cell lysate | +Inquiry |
CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL16 Products
Required fields are marked with *
My Review for All CXCL16 Products
Required fields are marked with *