Recombinant Human CXCL9 protein, His&Myc-tagged
| Cat.No. : | CXCL9-2775H |
| Product Overview : | Recombinant Human CXCL9 protein(Q07325)(23-125aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 23-125aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.7 kDa |
| AA Sequence : | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ] |
| Official Symbol | CXCL9 |
| Synonyms | CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10; |
| Gene ID | 4283 |
| mRNA Refseq | NM_002416 |
| Protein Refseq | NP_002407 |
| MIM | 601704 |
| UniProt ID | Q07325 |
| ◆ Recombinant Proteins | ||
| CXCL9-17H | Recombinant Human CXCL9 protein | +Inquiry |
| CXCL9-36M | Recombinant Mouse CXCL9 Protein, Biotin-tagged | +Inquiry |
| Cxcl9-2776M | Recombinant Mouse Cxcl9 protein, His-tagged | +Inquiry |
| CXCL9-18H | Recombinant Human CXCL9 Protein, Biotin-tagged | +Inquiry |
| CXCL9-02P | Recombinant Pig CXCL9 Protein (Thr23-Thr126), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Native Proteins | ||
| CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL9 Products
Required fields are marked with *
My Review for All CXCL9 Products
Required fields are marked with *
