Recombinant Human DCD protein, His-B2M-tagged
| Cat.No. : | DCD-2803H |
| Product Overview : | Recombinant Human DCD protein(P81605)(20-110aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 20-110aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLG kDaVEDLESVGKGAVHDVKDVLDSVL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DCD dermcidin [ Homo sapiens ] |
| Official Symbol | DCD |
| Synonyms | DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930; |
| Gene ID | 117159 |
| mRNA Refseq | NM_053283 |
| Protein Refseq | NP_444513 |
| MIM | 606634 |
| UniProt ID | P81605 |
| ◆ Recombinant Proteins | ||
| DCD-2388H | Recombinant Human DCD Protein, GST-tagged | +Inquiry |
| DCD-8144H | Recombinant Human DCD protein, His-tagged | +Inquiry |
| DCD-2799H | Recombinant Human DCD Protein, His-tagged, OVA Conjugated | +Inquiry |
| DCD-1183S | Recombinant Streptomyces coelicolor A3(2) DCD protein, His-tagged | +Inquiry |
| DCD-665H | Recombinant Human DCD protein(Ser63-Val109), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCD-7053HCL | Recombinant Human DCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCD Products
Required fields are marked with *
My Review for All DCD Products
Required fields are marked with *
