Recombinant Human DSP Protein (78-300 aa), His-tagged
Cat.No. : | DSP-1381H |
Product Overview : | Recombinant Human DSP Protein (78-300 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 78-300 aa |
Description : | Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.1 kDa |
AA Sequence : | CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | DSP desmoplakin [ Homo sapiens ] |
Official Symbol | DSP |
Synonyms | DSP; desmoplakin; DPI; DPII; KPPS2; PPKS2; desmoplakin I; DP; |
Gene ID | 1832 |
mRNA Refseq | NM_001008844 |
Protein Refseq | NP_001008844 |
MIM | 125647 |
UniProt ID | P15924 |
◆ Recombinant Proteins | ||
DSP-1195H | Recombinant Human DSP Protein, His-SUMO-tagged | +Inquiry |
DSP-1381H | Recombinant Human DSP Protein (78-300 aa), His-tagged | +Inquiry |
DSP-12182H | Recombinant Human DSP, GST-tagged | +Inquiry |
DSP-401H | Recombinant Human DSP Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSP Products
Required fields are marked with *
My Review for All DSP Products
Required fields are marked with *
0
Inquiry Basket