Recombinant Human DSP Protein, His-SUMO-tagged
Cat.No. : | DSP-1195H |
Product Overview : | Recombinant Human DSP Protein (78-300aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 78-300 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQE QMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQH INSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWIN DCEEEELLYDWSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | DSP desmoplakin [ Homo sapiens ] |
Official Symbol | DSP |
Synonyms | DSP; desmoplakin; desmoplakin (DPI, DPII); DPI; DPII; KPPS2; PPKS2; desmoplakin I; desmoplakin II; 250/210 kDa paraneoplastic pemphigus antigen; DP |
Gene ID | 1832 |
mRNA Refseq | NM_001008844 |
Protein Refseq | NP_001008844 |
MIM | 125647 |
UniProt ID | P15924 |
◆ Recombinant Proteins | ||
DSP-401H | Recombinant Human DSP Protein, His-tagged | +Inquiry |
DSP-1195H | Recombinant Human DSP Protein, His-SUMO-tagged | +Inquiry |
DSP-12182H | Recombinant Human DSP, GST-tagged | +Inquiry |
DSP-1381H | Recombinant Human DSP Protein (78-300 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSP Products
Required fields are marked with *
My Review for All DSP Products
Required fields are marked with *