Recombinant Human EFNB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EFNB1-864H
Product Overview : EFNB1 MS Standard C13 and N15-labeled recombinant protein (NP_004420) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Molecular Mass : 38 kDa
AA Sequence : MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EFNB1 ephrin-B1 [ Homo sapiens (human) ]
Official Symbol EFNB1
Synonyms EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia), EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782;
Gene ID 1947
mRNA Refseq NM_004429
Protein Refseq NP_004420
MIM 300035
UniProt ID P98172

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNB1 Products

Required fields are marked with *

My Review for All EFNB1 Products

Required fields are marked with *

0
cart-icon