Recombinant Human EFNB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EFNB1-864H |
Product Overview : | EFNB1 MS Standard C13 and N15-labeled recombinant protein (NP_004420) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. |
Molecular Mass : | 38 kDa |
AA Sequence : | MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EFNB1 ephrin-B1 [ Homo sapiens (human) ] |
Official Symbol | EFNB1 |
Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia), EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
Gene ID | 1947 |
mRNA Refseq | NM_004429 |
Protein Refseq | NP_004420 |
MIM | 300035 |
UniProt ID | P98172 |
◆ Recombinant Proteins | ||
Efnb1-7434R | Active Recombinant Rat Efnb1 protein(Met1-Thr229), hFc-tagged | +Inquiry |
EFNB1-1375H | Acitve Recombinant Human EFNB1 protein(Met 1-Lys 237), His&hFc-tagged | +Inquiry |
EFNB1-2238H | Active Recombinant Human EFNB1 protein, His-tagged | +Inquiry |
EFNB1-1383H | Recombinant Human EFNB1 Protein, MYC/DDK-tagged | +Inquiry |
EFNB1-2239H | Recombinant Human EFNB1, Fc-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *