Recombinant Human EXOG Protein, GST-tagged

• Cat.No.: EXOG-3565H
• Product Overview: Human ENDOGL1 partial ORF ( NP_005098.1, 269 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18. [provided by RefSeq, Feb 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXOG endo/exonuclease (5-3), endonuclease G-like [ Homo sapiens ]
• Official Symbol: EXOG
• Synonyms: EXOG; endo/exonuclease (5-3), endonuclease G-like; ENDOGL1, ENDOGL2, endonuclease G like 1 , endonuclease G like 2; nuclease EXOG, mitochondrial; ENGL; ENGL a; ENGL b; endo G-like 1; endonuclease G-like 1; endonuclease G-like 2; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2; MGC125944; MGC125945
• Gene ID: 9941
• mRNA Refseq: NM_001145464
• Protein Refseq: NP_001138936
• MIM: 604051
• UniProt ID: Q9Y2C4