Recombinant Human EXOG Protein, GST-tagged

Cat.No. : EXOG-3565H
Product Overview : Human ENDOGL1 partial ORF ( NP_005098.1, 269 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18. [provided by RefSeq, Feb 2009]
Molecular Mass : 36.74 kDa
AA Sequence : LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOG endo/exonuclease (5-3), endonuclease G-like [ Homo sapiens ]
Official Symbol EXOG
Synonyms EXOG; endo/exonuclease (5-3), endonuclease G-like; ENDOGL1, ENDOGL2, endonuclease G like 1 , endonuclease G like 2; nuclease EXOG, mitochondrial; ENGL; ENGL a; ENGL b; endo G-like 1; endonuclease G-like 1; endonuclease G-like 2; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2; MGC125944; MGC125945;
Gene ID 9941
mRNA Refseq NM_001145464
Protein Refseq NP_001138936
MIM 604051
UniProt ID Q9Y2C4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EXOG Products

Required fields are marked with *

My Review for All EXOG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon