Recombinant Human EXOG Protein, GST-tagged
Cat.No. : | EXOG-3565H |
Product Overview : | Human ENDOGL1 partial ORF ( NP_005098.1, 269 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18. [provided by RefSeq, Feb 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOG endo/exonuclease (5-3), endonuclease G-like [ Homo sapiens ] |
Official Symbol | EXOG |
Synonyms | EXOG; endo/exonuclease (5-3), endonuclease G-like; ENDOGL1, ENDOGL2, endonuclease G like 1 , endonuclease G like 2; nuclease EXOG, mitochondrial; ENGL; ENGL a; ENGL b; endo G-like 1; endonuclease G-like 1; endonuclease G-like 2; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2; MGC125944; MGC125945; |
Gene ID | 9941 |
mRNA Refseq | NM_001145464 |
Protein Refseq | NP_001138936 |
MIM | 604051 |
UniProt ID | Q9Y2C4 |
◆ Recombinant Proteins | ||
EXOG-12592H | Recombinant Human EXOG, GST-tagged | +Inquiry |
EXOG-3565H | Recombinant Human EXOG Protein, GST-tagged | +Inquiry |
EXOG-12593H | Recombinant Human EXOG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOG-6506HCL | Recombinant Human EXOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOG Products
Required fields are marked with *
My Review for All EXOG Products
Required fields are marked with *