Recombinant Human EXOG protein, His-tagged
Cat.No. : | EXOG-12593H |
Product Overview : | Recombinant Human EXOG protein (141-368 aa) was fused to His-tag and expressed in E.coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 228 |
Description : | This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 28 kDa |
AA Sequence : | FPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for (1-2 weeks); Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | EXOG |
Official Symbol | EXOG |
Synonyms | ENGL; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2 |
Gene ID | 9941 |
mRNA Refseq | NM_005107.4 |
Protein Refseq | NP_005098.2 |
MIM | 604051 |
UniProt ID | Q9Y2C4 |
◆ Recombinant Proteins | ||
EXOG-3565H | Recombinant Human EXOG Protein, GST-tagged | +Inquiry |
EXOG-12592H | Recombinant Human EXOG, GST-tagged | +Inquiry |
EXOG-12593H | Recombinant Human EXOG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOG-6506HCL | Recombinant Human EXOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EXOG Products
Required fields are marked with *
My Review for All EXOG Products
Required fields are marked with *
0
Inquiry Basket