Recombinant Human EXOG protein, His-tagged

• Cat.No.: EXOG-12593H
• Product Overview: Recombinant Human EXOG protein (141-368 aa) was fused to His-tag and expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 228
• Description: This gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell death. Alternatively spliced transcript variants have been described. A pseudogene exists on chromosome 18.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5% trehalose and 5% mannitol are added as protectants before lyophilization.
• Molecular Mass: 28 kDa
• AA Sequence: FPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for (1-2 weeks); Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: EXOG
• Official Symbol: EXOG
• Synonyms: ENGL; ENGLA; ENGLB; ENGL-a; ENGL-b; ENDOGL1; ENDOGL2
• Gene ID: 9941
• mRNA Refseq: NM_005107.4
• Protein Refseq: NP_005098.2
• MIM: 604051
• UniProt ID: Q9Y2C4